PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g22570.1.p
Common NameBRADI_5g22570, LOC100829867
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 788aa    MW: 85219 Da    PI: 6.5115
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g22570.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.5e-19116168456
                       -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++t++q++e+e++++++++p+ ++r+eL+++lgL+  qVk+WFqN+R++ k
  Bradi5g22570.1.p 116 YHRHTQHQIQEMEAFYKECQHPDDKQRKELSRELGLEPLQVKFWFQNKRTQTK 168
                       6789**********************************************998 PP

2START180.69.1e-572965191206
                       HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS.............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT- CS
             START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv............dsgealrasgvvdmvlallveellddkeqWdetl 76 
                       ela +a++el+++  ++ep+W         e +n++e+ + f  ++               +ea+r+s+vv+ ++a+lve+l+d++ q+   +
  Bradi5g22570.1.p 296 ELAVAAMEELLRMTRLNEPLWAGPGvagpmETLNEEEYARMF--GGPrggglgpkqygqLVSEASRESAVVILTPANLVEILMDVN-QYAAVF 385
                       57899****************9876779999***********..4445689***********************************.666666 PP

                       S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEEC CS
             START  77 a....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepks 158
                            +a+tlev+s+g      galq+m+ e+q++splvp R+++fvRy++q ++g+w++vdvS+d  q        ++++++pSg+li++ +
  Bradi5g22570.1.p 386 SsivsRAATLEVLSTGvagcydGALQVMSVEFQVPSPLVPtRESYFVRYCKQNSDGTWAVVDVSLDTLQG-------IKCRRRPSGCLIQEAP 471
                       55555*************************************************************9987.......78************** PP

                       TCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 159 nghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       ng+skvtwvehv++++r++h++++ lv+sgla+ga++wv +l+rqce+
  Bradi5g22570.1.p 472 NGYSKVTWVEHVEVDDRSVHNIYKLLVNSGLAFGARRWVGALGRQCER 519
                       **********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-2099168IPR009057Homeodomain-like
SuperFamilySSF466896.68E-18103171IPR009057Homeodomain-like
CDDcd000861.10E-17108171No hitNo description
PROSITE profilePS5007115.726110170IPR001356Homeobox domain
SMARTSM003894.2E-16111174IPR001356Homeobox domain
PfamPF000462.0E-16116168IPR001356Homeobox domain
PROSITE patternPS000270145168IPR017970Homeobox, conserved site
PROSITE profilePS5084835.654287522IPR002913START domain
CDDcd088756.33E-107291518No hitNo description
SuperFamilySSF559614.56E-32294521No hitNo description
SMARTSM002341.1E-46296519IPR002913START domain
PfamPF018523.8E-47297519IPR002913START domain
Gene3DG3DSA:3.30.530.202.3E-5361512IPR023393START-like domain
SuperFamilySSF559612.15E-23540777No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 788 aa     Download sequence    Send to blast
MMIPVRHMPS SMIGRSSAAY GSSSSALSLG QPNLLDSNHQ QLHHHQALLN HQIPAPAMAE  60
SSDNSGRRSM VRRRSEPLGE DFESRSGSEN VDGDGVEDEL QQQADPNKRP RKQNRYHRHT  120
QHQIQEMEAF YKECQHPDDK QRKELSRELG LEPLQVKFWF QNKRTQTKNQ QERHENSQLR  180
GENDKLRAEN MRYKEALSSA SCPSCGGPAA LGEMSFDEHH LRLENARLRD EIDRISAIAA  240
KYVGKPAVPF PVLSNPLAAV GAYGHHHLGA DMFGELQQPM RPTGGAGDQN KGVVVELAVA  300
AMEELLRMTR LNEPLWAGPG VAGPMETLNE EEYARMFGGP RGGGLGPKQY GQLVSEASRE  360
SAVVILTPAN LVEILMDVNQ YAAVFSSIVS RAATLEVLST GVAGCYDGAL QVMSVEFQVP  420
SPLVPTRESY FVRYCKQNSD GTWAVVDVSL DTLQGIKCRR RPSGCLIQEA PNGYSKVTWV  480
EHVEVDDRSV HNIYKLLVNS GLAFGARRWV GALGRQCERL ASVMASNIPN SDIGVITSSE  540
GKKSMLKLAE RMVASFCGGV TASVAHQWTR LSGSGAEDVR VMTRQSVDDP GRPPGIVLNA  600
ATSFWLPVPP KRVFDFLRDE TSRSQWDILS NGGVVQEMAH IANGRDHGNC VSLLRVNSTN  660
SNQSNMLILQ ESCTDASGSY VIYAPVDIVA MNVVLNGGDP DYVALLPSGF AILPDGPAGN  720
IHTGGGPSVS DGGVGSGGSL LTVAFQILVD SVPTAKLSLG SVATVNSLIA CTVERIKAAV  780
SGESSPQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580598.10.0PREDICTED: homeobox-leucine zipper protein ROC2-like
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLI1J2400.0I1J240_BRADI; Uncharacterized protein
STRINGBRADI5G22570.20.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2